General Information

  • ID:  hor001878
  • Uniprot ID:  P63293
  • Protein name:  Somatoliberin
  • Gene name:  GHRH
  • Organism:  Capra hircus (Goat)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Capra (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0032880 regulation of protein localization
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
  • Length:  44
  • Propeptide:  YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
  • Signal peptide:  NA
  • Modification:  T44 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulate the secretion of growth hormone
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GHRHR
  • Target Unid:  A0A452EXC5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q61839-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q61839-F1.pdbhor001878_AF2.pdbhor001878_ESM.pdb

Physical Information

Mass: 587600 Formula: C220H365N71O67S
Absent amino acids: CHPW Common amino acids: Q
pI: 10.7 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 14
Hydrophobicity: -85.23 Boman Index: -12721
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 84.32
Instability Index: 2671.59 Extinction Coefficient cystines: 2980
Absorbance 280nm: 69.3

Literature

  • PubMed ID:  6440561
  • Title:  Growth Hormone-Releasing Factor From Ovine and Caprine Hypothalamus: Isolation, Sequence Analysis and Total Synthesis